PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676761510
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family SRS
Protein Properties Length: 270aa    MW: 28459.2 Da    PI: 7.4182
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676761510genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702110.42.8e-34134194363
     DUF702   3 sgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasska 63 
                sg+ sCqdCGnqakkdCah+RCRtCCksrg++C thvkstWvpaakrrerqqqla++++ +
  676761510 134 SGAPSCQDCGNQAKKDCAHMRCRTCCKSRGLECPTHVKSTWVPAAKRRERQQQLASSQQPE 194
                67889**************************************************998765 PP

2DUF70290.92.8e-2818925093154
     DUF702  93 saeskkeletsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                s+++++ l++ ++P+evss+a+frcvrvssvddge+e+aY+tavsigGhvfkGiLydqG++e
  676761510 189 SSQQPEGLQIGNFPPEVSSPAIFRCVRVSSVDDGEDEYAYKTAVSIGGHVFKGILYDQGPAE 250
                56788899999************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051422.9E-30137192IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016232.2E-27138180IPR006510Zinc finger, lateral root primordium type 1
PfamPF051422.0E-24197249IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016243.9E-27201248IPR006511Lateral Root Primordium type 1, C-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 270 aa     Download sequence    Send to blast
MAGFFSLGNG GGRDGGGGSS QDEHNHHHRP NTNNNNPSPS GTESWLWCRN PNSNANANAN  60
AGGGDIAPSY KGTLELWQNP SNQEMLFQQQ QRLDLYTSAA GLGVGPSNRT FIESSGGGAA  120
ALMMMRSGGG DGGSGAPSCQ DCGNQAKKDC AHMRCRTCCK SRGLECPTHV KSTWVPAAKR  180
RERQQQLASS QQPEGLQIGN FPPEVSSPAI FRCVRVSSVD DGEDEYAYKT AVSIGGHVFK  240
GILYDQGPAE RSSSGGGSQP IRVLEREGGG
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11017GGRDGGGG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHM2229251e-174HM222925.1 Thellungiella parvula folic acid transporter gene, complete cds; glutaredoxin gene, complete sequence; kinesin motor family protein, NAC105, zinc finger CCCH-type protein, phosphatidic acid phosphatase, pentatricopeptide repeat protein, GTP binding protein, GAMMA CA3/carbonate dehydratase, and pentatricopeptide repeat genes, complete cds; and unknown genes.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006393825.11e-135hypothetical protein EUTSA_v10004509mg
SwissprotQ9XGX01e-126SHI_ARATH; Protein SHORT INTERNODES
TrEMBLQ0ZR591e-135Q0ZR59_EUTHA; Putative uncharacterized protein
TrEMBLV4MIE91e-135V4MIE9_EUTSA; Uncharacterized protein
STRINGAT5G66350.11e-124(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34192864
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66350.11e-114Lateral root primordium (LRP) protein-related